Protein Info for GFF7243 in Variovorax sp. SCN45

Annotation: HtrA protease/chaperone protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 PF00089: Trypsin" amino acids 33 to 195 (163 residues), 54.4 bits, see alignment E=3.9e-18 PF13365: Trypsin_2" amino acids 49 to 182 (134 residues), 118.6 bits, see alignment E=9.8e-38 PF00595: PDZ" amino acids 222 to 299 (78 residues), 26.7 bits, see alignment E=1.5e-09 PF13180: PDZ_2" amino acids 222 to 308 (87 residues), 44.5 bits, see alignment E=3.9e-15 PF17820: PDZ_6" amino acids 248 to 301 (54 residues), 31.9 bits, see alignment 2.1e-11

Best Hits

KEGG orthology group: None (inferred from 51% identity to mep:MPQ_1787)

Predicted SEED Role

"HtrA protease/chaperone protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (427 amino acids)

>GFF7243 HtrA protease/chaperone protein (Variovorax sp. SCN45)
VVDISTLRIGRDENQEDIELEIAPELDFADRLAWPLPASARISQIRDLASGLIIRSDGLI
LTSAHVVANVDEVRVQLDDGRRFTARVAGSDRRTDVALLKIDATDLPVAVIGDSSALAPG
EWVAAIGSPFGFHGSVTAGVVSAVGRVMAGAGEIPFIQTDVAINPGSSGSPLLNSRGEVV
GINSMIYSGSGGYMGLSFAVPIDLSMRIAGELLAHGTVHRAYLGAEFQEMTPALAQSFGL
PAPTGALVVRVEADSPAESAGLAQGDAVLALDGKPVARFLDLPQQIAQRPPGSRMQLEVW
RHGAPRVLRATLAVQPAAASRAFTTAAPEWNDGLGLSLGVLSPAQRLQLHIDSGLMVREA
DGLARSEGILAGDVVVAMNTTKLYRVEDLGQALARVPAGNTVALLVMRDRRLAYVAVRLP
AARHGRS