Protein Info for GFF7201 in Variovorax sp. SCN45

Annotation: Alkanesulfonates transport system permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 transmembrane" amino acids 27 to 47 (21 residues), see Phobius details amino acids 84 to 106 (23 residues), see Phobius details amino acids 117 to 135 (19 residues), see Phobius details amino acids 141 to 160 (20 residues), see Phobius details amino acids 185 to 208 (24 residues), see Phobius details amino acids 237 to 256 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 93 to 265 (173 residues), 95.4 bits, see alignment E=1.8e-31

Best Hits

Swiss-Prot: 35% identical to SSUC_BACSU: Putative aliphatic sulfonates transport permease protein SsuC (ssuC) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 89% identity to vap:Vapar_1910)

Predicted SEED Role

"Alkanesulfonates transport system permease protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (271 amino acids)

>GFF7201 Alkanesulfonates transport system permease protein (Variovorax sp. SCN45)
MSGIARDAAELAAVQPLRPAEGSRWRGLVLPVTALALWWLLSSLDIANSALLVSPAKVFD
TAAEQVASGRLWRALSASLAREATGFTIGTASGLVLGALLGLSPLFNRIVGPSFNTFKQI
SLFAWIPLISVWFGLGDVAKVVFLSLAALVPVVVNTCDGIRTVPPGLLEVARVYGFTRWQ
TVTQVVLPAALPAIFTGVYLALIYSWLATIGAEYLLVSGKGIGNTLIEGSEHFQMDLVIF
GMVVIGTVGWLMNASARALERRLARWTGRAT