Protein Info for GFF7197 in Variovorax sp. SCN45

Annotation: no description

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 PF00005: ABC_tran" amino acids 38 to 191 (154 residues), 114.9 bits, see alignment E=4.6e-37

Best Hits

KEGG orthology group: K02032, peptide/nickel transport system ATP-binding protein (inferred from 48% identity to psp:PSPPH_4234)

MetaCyc: 43% identical to nickel ABC transporter ATP binding subunit NikE (Escherichia coli K-12 substr. MG1655)
7.2.2.i [EC: 7.2.2.i]; 7.2.2.- [EC: 7.2.2.i]

Predicted SEED Role

No annotation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.2.i

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (278 amino acids)

>GFF7197 no description (Variovorax sp. SCN45)
MAELPLLQVQDLVARHALAGVPAFGGLVKRKRWLQAVDGVSFTLARGEALGLVGESGCGK
STLVSLLARLSDPVSGRIVFDGTDLAGHPAASAARAPWRRRVQMVFQDPHDSLDPRGTAF
DAIAAPIRGLMGLDAGAVRSRVLEMAQRVQLGPDLLQRRPHELSGGQAARVGIARALGPG
PELLILDEPTAALDVSVQAGVLALLDRLRRELGLAIVFVSHDLGVVRLLCERVLVMREGR
IVDQGPAGELLDRPAHAYTAALVAAIPRFPDRPSAFFP