Protein Info for GFF7196 in Variovorax sp. SCN45

Annotation: Oxygen-insensitive NADPH nitroreductase (EC 1.-.-.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 PF00881: Nitroreductase" amino acids 43 to 197 (155 residues), 81.3 bits, see alignment E=9.6e-27 PF28600: Nitroreductase_C" amino acids 207 to 282 (76 residues), 60.2 bits, see alignment E=2.7e-20

Best Hits

KEGG orthology group: None (inferred from 62% identity to tmz:Tmz1t_1161)

Predicted SEED Role

"Oxygen-insensitive NADPH nitroreductase (EC 1.-.-.-)" (EC 1.-.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (283 amino acids)

>GFF7196 Oxygen-insensitive NADPH nitroreductase (EC 1.-.-.-) (Variovorax sp. SCN45)
MTASHTPPDTDHGFAGLWHARYGEGIAPSAPATPNPVLQSLLAHRSVRAFDPAPLDEGTL
EWLIAAAQSAPSSSNLQTWSVVAVQDPARKARLAELAGGQDHVRDAPLVLVWLADLARLR
GLAQQAQVPVEGADYLDSSLMGVIDAVLAAQNAVVAAQSLGLGTVYLGAIRNQPERVAEE
LGLPPGVFAVVGLCVGRPDAARPAAIKPRLPQAAVLSRERYARPEAQRHVQRYDATMQSF
YAAQGMPVARWSEHSLARLRGPEQLRGRHRLVEALQAQHIGLR