Protein Info for GFF7193 in Variovorax sp. SCN45

Annotation: ABC transporter, permease protein 1 (cluster 5, nickel/peptides/opines)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 transmembrane" amino acids 17 to 38 (22 residues), see Phobius details amino acids 110 to 131 (22 residues), see Phobius details amino acids 143 to 168 (26 residues), see Phobius details amino acids 210 to 231 (22 residues), see Phobius details amino acids 256 to 281 (26 residues), see Phobius details amino acids 312 to 333 (22 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 15 to 111 (97 residues), 50.2 bits, see alignment E=2.9e-17 PF00528: BPD_transp_1" amino acids 122 to 341 (220 residues), 106.2 bits, see alignment E=1.8e-34

Best Hits

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 60% identity to azc:AZC_1958)

Predicted SEED Role

"Dipeptide transport system permease protein DppB (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (345 amino acids)

>GFF7193 ABC transporter, permease protein 1 (cluster 5, nickel/peptides/opines) (Variovorax sp. SCN45)
VSTGTPLGLAGRVAARMLAALPVLAGAVVFTFLLTHVLPGDPAAFLASGPSAGPEEIAQI
RARMGLDQPLPVQLWHYLAALAQGDWGQSHTTGQPVWTDLRQRLPATLELTFVAFTLTLA
VALPLGAAAALRPRSIWDRACTLLTVGGSCMPTFVIALLLVYVFYFLLGWAPEPTGRIDA
MLAPPPAVTGFLLVDSLLAGRADAFASAAGRLLLPAVAMALFSLAPLARLMRASLLGVLR
SDPVRTARALGLPRRAVLASALHLALLPVVTGAGMVFSYMLSANVVIEKVFAWPGIGSYA
LDALLASDHAPLQGFVLLVALLFVGVNLGVDLLHGRIDPRAGSQA