Protein Info for PS417_03655 in Pseudomonas simiae WCS417

Annotation: short-chain dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF08659: KR" amino acids 9 to 158 (150 residues), 27.6 bits, see alignment E=4e-10 PF00106: adh_short" amino acids 11 to 192 (182 residues), 128.8 bits, see alignment E=2.9e-41 PF13561: adh_short_C2" amino acids 13 to 228 (216 residues), 99.3 bits, see alignment E=3.9e-32

Best Hits

KEGG orthology group: None (inferred from 96% identity to pfs:PFLU0748)

Predicted SEED Role

"Oxidoreductase, short-chain dehydrogenase/reductase family (EC 1.1.1.-)" (EC 1.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-

Use Curated BLAST to search for 1.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U4F8 at UniProt or InterPro

Protein Sequence (260 amino acids)

>PS417_03655 short-chain dehydrogenase (Pseudomonas simiae WCS417)
MSLTPPRRYWLTGASSGIGAALAVELLNSGAHVALSSRTKGPLEALAQRYPGQVLVVAGD
LTNSQTVREIGEHIGVVWGSLDTVILNAGTCEYVDARQFDSSIIEHVVRTNLLASSYCIE
AALPLLRAGQTPHLVGVASAVTYLPMPRAEAYGASKAGLRYLFESLRISLSPENIDVTVI
SPGFVDTPLTERNDFPMPLSWSADKAARHIFAKLEKRPLEIAFPALFIATLWPLSKLPNR
AQLIIGKRMLRSPPPKKDDL