Protein Info for GFF717 in Sphingobium sp. HT1-2

Annotation: 23S rRNA (adenine(2503)-C(2))-methyltransferase @ tRNA (adenine(37)-C(2))-methyltransferase (EC 2.1.1.192)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00048: 23S rRNA (adenine(2503)-C(2))-methyltransferase
  • amino acids 29 to 402 (374 residues), 370.9 bits, E=2.9e-115
• PF21016: RlmN_N
  • amino acids 32 to 94 (63 residues), 45.9 bits, E=3.8e-16
• PF04055: Radical_SAM
  • amino acids 139 to 328 (190 residues), 60.1 bits, E=3.1e-20

Best Hits

Swiss-Prot: 80% identical to RLMN_NOVAD: Dual-specificity RNA methyltransferase RlmN (rlmN) from Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CIP 105152 / NBRC 16084 / F199)

KEGG orthology group: K06941, ribosomal RNA large subunit methyltransferase N [EC: 2.1.1.-] (inferred from 90% identity to sjp:SJA_C1-09080)

Predicted SEED Role

"Ribosomal RNA large subunit methyltransferase N (EC 2.1.1.-)" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Protein Sequence (419 amino acids)

>GFF717 23S rRNA (adenine(2503)-C(2))-methyltransferase @ tRNA (adenine(37)-C(2))-methyltransferase (EC 2.1.1.192) (Sphingobium sp. HT1-2)
MHSAANPIMPIPGLIDPVPVPRAVTPREDGRVDMLGLTRAQMKGVLEEAGLDQKAAKLRS
KQLFHWLYHRGETDFEKMTDLAKPMRLWMAERFIVGRPQVVEAQVSNDGTRKWLLRSDDG
QDYEMVFIPDADRGTLCVSSQVGCTLNCSFCHTGTMRLVRNLTPGEIVGQVMLARDALGE
WPKGSMASANDDETDEDSQYTADGRMLTNIVMMGMGEPLYNFDHVRDALKLVMDGDGLAL
SKRRITLSTSGVVPMMARAAEEIGVNLAVSLHAVTKEVRDELVPLNRKYGIEELLQACAD
YPKANNARRITFEYVMIKDKNDSDADAHELVRLIRKYKLPAKVNLIPFNPWPGTDYECSS
PERIRAFSTIVFEGGISAPVRTPRGRDIMAACGQLKSASEKKSKAELKRLAEEKQAALG