Protein Info for GFF715 in Xanthobacter sp. DMC5

Annotation: DNA topoisomerase 4 subunit A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 745 TIGR01062: DNA topoisomerase IV, A subunit" amino acids 13 to 744 (732 residues), 881 bits, see alignment E=3e-269 PF00521: DNA_topoisoIV" amino acids 37 to 475 (439 residues), 483.6 bits, see alignment E=5.8e-149 PF03989: DNA_gyraseA_C" amino acids 558 to 602 (45 residues), 10.5 bits, see alignment 3.4e-05 amino acids 609 to 639 (31 residues), 8.4 bits, see alignment (E = 0.00016) amino acids 655 to 692 (38 residues), 26 bits, see alignment 5.1e-10

Best Hits

Swiss-Prot: 66% identical to PARC_RHIME: DNA topoisomerase 4 subunit A (parC) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K02621, topoisomerase IV subunit A [EC: 5.99.1.-] (inferred from 94% identity to xau:Xaut_3884)

Predicted SEED Role

"Topoisomerase IV subunit A (EC 5.99.1.-)" in subsystem DNA topoisomerases, Type II, ATP-dependent or Resistance to fluoroquinolones (EC 5.99.1.-)

Isozymes

Compare fitness of predicted isozymes for: 5.99.1.-

Use Curated BLAST to search for 5.99.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (745 amino acids)

>GFF715 DNA topoisomerase 4 subunit A (Xanthobacter sp. DMC5)
MATRTLPPGDGNIEKVTLKEALEERYLAYALSTIMHRALPDARDGLKPVHRRILHAMRQL
RLDPGQGFKKSARVVGDVIGKFHPHGDQSVYDALVRLAQDFAQRYPLVDGQGNFGNVDGD
NAAAMRYTEARLTETARLLLDGIDEDAVDFRPTYDGSEEEPAVLPAAFPNLLANGSQGIA
VGMATSIPPHNAAELLDAALHLIDHPDALAFDLLKFVPGPDFPTGGVLVEDPVGVAEAYA
TGRGSFRVRARWEKEDTGRGGYVVVVTEIPYGVAKSRLVEKIAELLTDKKLPLLADVRDE
SAEDIRLVLEPRTRTVDAEVLMESLFKLTELEARIPLNMNVLVKGQIPKVLSLAEALREW
LDHRRDVLLRRSRYRLDQIAHRLEVLGGYLIAYLNLDEVIRIIREEDEPKVSLMQTFELT
DVQAEAILNMRLRSLRRLEEMEIRKEHDALSKEQDGLNRLVASETAQWKAISKEIRETRK
TYGPETALGRRRTTFAAAPTVHEDAFTEALVEREPVTVVVSAKGWIRALKGHVADVSNLQ
FKGDDSHGHAFFAETTSKVMVFASNGRFYTLDASKLPGGRGHGEPVRLMIDLEQEAEIVS
VFAYQAGRKLLVASKQGRGFVVPEDDCLANTRKGKQVLVTDPPDAALAVRFVDGDWVAVI
GENRKMLVFPLNQIPEMSRGRGVRLQRYKDGGLSDLKVFPMATGLTWEDTSGRTWTVTDL
IEWQGERASAGRLPPKGFPRTNTFG