Protein Info for PS417_03635 in Pseudomonas simiae WCS417

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 159 transmembrane" amino acids 24 to 43 (20 residues), see Phobius details amino acids 50 to 73 (24 residues), see Phobius details amino acids 80 to 99 (20 residues), see Phobius details amino acids 107 to 127 (21 residues), see Phobius details amino acids 134 to 154 (21 residues), see Phobius details PF11086: DUF2878" amino acids 5 to 151 (147 residues), 147.7 bits, see alignment E=1.7e-47

Best Hits

KEGG orthology group: None (inferred from 88% identity to pfs:PFLU0744)

Predicted SEED Role

"FIG024285: Hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TUQ7 at UniProt or InterPro

Protein Sequence (159 amino acids)

>PS417_03635 membrane protein (Pseudomonas simiae WCS417)
MLKTLANAVLFQCGWFACVLGGDSVWLLVGLAVLAIHLLWISSWAADGKLILAVTVVGTL
LDTTLRALGVFQFTEPGPLIPFWLILLWALLATTLRHCLAWSARPSWRAAILGAVGGPLS
YFAGSQLAGVKFGFALAPTMVVLALLWAVVFVGLHRLAR