Protein Info for GFF7148 in Variovorax sp. SCN45

Annotation: D-amino-acid oxidase (EC 1.4.3.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 367 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF00890: FAD_binding_2" amino acids 4 to 106 (103 residues), 24.5 bits, see alignment E=2.3e-09 PF01266: DAO" amino acids 4 to 345 (342 residues), 231.8 bits, see alignment E=2.6e-72 PF13450: NAD_binding_8" amino acids 7 to 37 (31 residues), 26 bits, see alignment (E = 1.4e-09)

Best Hits

KEGG orthology group: None (inferred from 91% identity to vpe:Varpa_5948)

MetaCyc: 69% identical to D-hydroxyproline dehydrogenase beta subunit (Pseudomonas aeruginosa PAO1)
1.14.19.-

Predicted SEED Role

"D-amino-acid oxidase (EC 1.4.3.3)" in subsystem Proline, 4-hydroxyproline uptake and utilization (EC 1.4.3.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (367 amino acids)

>GFF7148 D-amino-acid oxidase (EC 1.4.3.3) (Variovorax sp. SCN45)
MDADAIVIGAGIVGAACAHALAQAGLRVLVLDARIGGATGAGMGHLVVMDDNAAELELSR
RSVAQWRALAPRMGEDCAYSPCGTLWIAANAEEMAEAERKQQRLHAHGIDGRLLTASGLA
RAEPALRKGLAGALEVPGDGILYAPNAARWLLAQAADAVRVEHAKVAAIQDDGTLRLADG
SRRSAPRIVLANGIEATALCPELPIRPKKGHLLITDRYPGTVHHQLVELGYVTSAHHSDG
DSVAFNVQPRPTGQLLVGSSRQFDTTDPAVEAPMLARMLQRTLDYLPGLANLNAVRSWTG
MRAASPDGLPLLGRHPWREKLWLAVGHEGLGVTTAPGSAHLLAALMTGAKPDFDAAPYAP
RGLRGMA