Protein Info for GFF7142 in Variovorax sp. SCN45

Annotation: Transcriptional regulator, LysR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 PF00126: HTH_1" amino acids 4 to 62 (59 residues), 70.2 bits, see alignment E=1.2e-23 PF03466: LysR_substrate" amino acids 89 to 292 (204 residues), 157.5 bits, see alignment E=3.1e-50

Best Hits

Swiss-Prot: 36% identical to Y1364_HAEIN: Uncharacterized HTH-type transcriptional regulator HI_1364 (HI_1364) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 69% identity to pap:PSPA7_2690)

Predicted SEED Role

"Transcriptional regulator, LysR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (295 amino acids)

>GFF7142 Transcriptional regulator, LysR family (Variovorax sp. SCN45)
MDHLTALKVFRTTAATGSFAGAARQMGLSAAAVSKNIAQLEAHLKVRLINRTTRQMSLTE
AGAAYHERLSRILDELSEADAALAPMGSSPGGVLRVSAPLTFALTSLSPAIPEFMARYPN
LRLELNLQDSRSDIIGEGYDLAIRGSDRLEDSSLVARRLMTMDHVLCGAPGYFATAGRPA
RPEDLKAHECVQFTLSGHANKWTFSRAGRSVAVPVDGRYKVSSSIAVRDALLAGFGLSLI
PRIYVEHELASGRLQAVLEDWEADKTPVYAVYPSRHLAAKTRVFVDFLAERFSGR