Protein Info for GFF7138 in Variovorax sp. SCN45

Annotation: ATP-dependent 23S rRNA helicase DbpA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 476 PF00270: DEAD" amino acids 39 to 204 (166 residues), 161.4 bits, see alignment E=3.4e-51 PF04851: ResIII" amino acids 53 to 200 (148 residues), 35.9 bits, see alignment E=1.4e-12 PF00271: Helicase_C" amino acids 249 to 348 (100 residues), 86.3 bits, see alignment E=3.5e-28 PF03880: DbpA" amino acids 402 to 472 (71 residues), 70.8 bits, see alignment E=1.6e-23

Best Hits

KEGG orthology group: K05591, ATP-independent RNA helicase DbpA [EC: 3.6.4.13] (inferred from 94% identity to vap:Vapar_5212)

Predicted SEED Role

"ATP-dependent 23S rRNA helicase DbpA"

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.13

Use Curated BLAST to search for 3.6.4.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (476 amino acids)

>GFF7138 ATP-dependent 23S rRNA helicase DbpA (Variovorax sp. SCN45)
MTTPNPTAGGTPADNGFAALALSPQMLANLTQLGYTQMTPIQAAALPPALLGKDLIAQAK
TGSGKTAAFALALLANLNARRFAIQAMVLCPTRELADQVTTEIRRLARAEENIKVVTLCG
GVALRGQVASLEHGAHIVVGTPGRIMDHLERENLDLSALNTLVLDEADRMLDMGFFDDIV
TVARQCPKERQTLLFSATYPEGIAKLAQQFMKNPEQITVQAQHEGSKIRQRWYQIKDSER
LHAVSLLLDHFRPVSTLAFCNTKQQCRDLVDVLQAQGFSALALFGELEQRERDQVLVQFA
NRSCSVLVATDVAARGLDISQLEAVINVDVTPDSEIHIHRVGRTGRVGQQGAAEGLALNL
ASMNEMGFVGKIEQLQGRESEWHELSELTPGKGSPLKPPMATLQIVGGRKEKIRAGDVLG
ALTGDCGYAKDQVGKINVNEFSTYVAVDRAIAAEAARKLSSGRVKGKSVKVRLLEQ