Protein Info for GFF7132 in Variovorax sp. SCN45

Annotation: Xylose isomerase-like TIM-barrel protein KPN_00539

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 PF01261: AP_endonuc_2" amino acids 30 to 222 (193 residues), 99.4 bits, see alignment E=1.4e-32

Best Hits

Predicted SEED Role

"Inosose isomerase (EC 5.3.99.-)" in subsystem Inositol catabolism (EC 5.3.99.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.3.99.-

Use Curated BLAST to search for 5.3.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (252 amino acids)

>GFF7132 Xylose isomerase-like TIM-barrel protein KPN_00539 (Variovorax sp. SCN45)
FSCPSFSKLTDFTAITLVRLEGGRSKASANLGLTAHATFSGALAWPYLYSWPPRQPGLIE
EAFDELARRWRPILDAFDAVGVDVGYEIHPGEDLHDGVSYEMFLERVNNHPRACLLYDPS
HFMLQQLDYLAYIDHYHERIKIFHVKDAEFNPTGKQGVYGGFQSWINRAGRFRSLGDGQV
NFKAIFSKMAQYDFPGWAVLEWECCIKHPEDGAREGAKFIADHIIRVADRAFDDFAAGGV
DVAANRRMLGLG