Protein Info for GFF712 in Xanthobacter sp. DMC5

Annotation: Putative transport protein YdiK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 transmembrane" amino acids 21 to 45 (25 residues), see Phobius details amino acids 51 to 71 (21 residues), see Phobius details amino acids 80 to 100 (21 residues), see Phobius details amino acids 139 to 145 (7 residues), see Phobius details amino acids 166 to 193 (28 residues), see Phobius details amino acids 231 to 250 (20 residues), see Phobius details amino acids 257 to 284 (28 residues), see Phobius details amino acids 290 to 309 (20 residues), see Phobius details amino acids 321 to 353 (33 residues), see Phobius details PF01594: AI-2E_transport" amino acids 34 to 358 (325 residues), 92.7 bits, see alignment E=1.3e-30

Best Hits

KEGG orthology group: None (inferred from 77% identity to xau:Xaut_4349)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (380 amino acids)

>GFF712 Putative transport protein YdiK (Xanthobacter sp. DMC5)
MERPHERRQDRPLIRDGSETFGPVLQLALRFGTLALLFGWCFTIVQPFLTSILWGLIIAI
ASHPLFIRLCAALNGRTATAATLFVVLALTLLVLPAMLLADTLVNSLKLLAHHMADGTLR
LPPPPAAVRGWFLVGEPLYSFWMLASTNLDQAISSVASELTWAGKWMLGSATGVLLGILE
FVVAIFVAAVLMANATSGQRIAGDVVTRLAGSGGLGYADLAVRTIRSVSKGIIGVALIQS
LLAGLGFLAADIPAAGLLALLCLIIAIVQLPLAIVLVPVAIYAFTLLDPMPAVIFAVWCA
GVSLIEHVLRPIMLGRGVDVPMLVVFIGAIGGLLSSGVLGLFVGPVVLALGYTLILHWLE
AEPARALEVEERRTDRPAAE