Protein Info for GFF7119 in Variovorax sp. SCN45

Annotation: Ortho-halobenzoate 1,2-dioxygenase beta-ISP protein OhbA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13577: SnoaL_4
  • amino acids 11 to 141 (131 residues), 30.8 bits, E=2.6e-11
• PF00866: Ring_hydroxyl_B
  • amino acids 18 to 150 (133 residues), 37.3 bits, E=2.9e-13

Best Hits

Swiss-Prot: 52% identical to TPDB1_COMSP: Terephthalate 1,2-dioxygenase, terminal oxygenase component subunit beta 1 (tphA3I) from Comamonas sp.

KEGG orthology group: K05709, small terminal subunit of phenylpropionate dioxygenase [EC: 1.14.12.19] (inferred from 52% identity to ctt:CtCNB1_1494)

MetaCyc: 51% identical to terephthalate 1,2-dioxygenase oxygenase component beta subunit (Comamonas testosteroni T-2)
Terephthalate 1,2-dioxygenase. [EC: 1.14.12.15]

Predicted SEED Role

"Ortho-halobenzoate 1,2-dioxygenase beta-ISP protein OhbA" in subsystem Benzoate degradation

MetaCyc Pathways

• terephthalate degradation (1/2 steps found)
• 3-phenylpropanoate and 3-(3-hydroxyphenyl)propanoate degradation to 2-hydroxypentadienoate (2/5 steps found)
• cinnamate and 3-hydroxycinnamate degradation to 2-hydroxypentadienoate (2/5 steps found)
• 3-phenylpropanoate and 3-(3-hydroxyphenyl)propanoate degradation (2/8 steps found)

KEGG Metabolic Maps

• 2,4-Dichlorobenzoate degradation
• Phenylalanine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.14.12.19

Use Curated BLAST to search for 1.14.12.15 or 1.14.12.19

Protein Sequence (158 amino acids)

>GFF7119 Ortho-halobenzoate 1,2-dioxygenase beta-ISP protein OhbA (Variovorax sp. SCN45)
MDEMVLTYRLARLNARYARSLAGDRLEEWPGYFEDKCIYRVTTRENHTEGLAGSLIYASS
KGMLEDRVQALREANIYERQGYRHLLGMPHIASDDGAVVKAETDFVVIRTMRTGQTDLFA
SGIYLDTVASTPTGELRLKERVVVCDSSRVDTLLAVPL