Protein Info for GFF71 in Xanthobacter sp. DMC5

Annotation: Biopolymer transport protein ExbD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 152 transmembrane" amino acids 27 to 53 (27 residues), see Phobius details TIGR02801: protein TolR" amino acids 24 to 147 (124 residues), 140.7 bits, see alignment E=2.1e-45 PF02472: ExbD" amino acids 24 to 147 (124 residues), 105.1 bits, see alignment E=1.5e-34

Best Hits

Swiss-Prot: 44% identical to EXBD_SHIFL: Biopolymer transport protein ExbD (exbD) from Shigella flexneri

KEGG orthology group: K03559, biopolymer transport protein ExbD (inferred from 94% identity to xau:Xaut_3058)

MetaCyc: 44% identical to Ton complex subunit ExbD (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Biopolymer transport protein ExbD/TolR" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (152 amino acids)

>GFF71 Biopolymer transport protein ExbD (Xanthobacter sp. DMC5)
MGMSGGGAAGWQSRRSRRRAAPVMAEINVTPMVDVMLVLLIIFMVAAPLLTVGVPIDLPQ
TQASAVNQDNKEPITLSVRPNGQIYLGDSEIKYEDLVSKLQAVTQARGGFEERIFVRGDK
NANYGQIMRVMGRLSGAGFKKVALVTEVEQGG