Protein Info for GFF71 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Minor fimbrial subunit StfF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 158 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF00419: Fimbrial" amino acids 23 to 158 (136 residues), 62.6 bits, see alignment E=2.9e-21

Best Hits

Swiss-Prot: 43% identical to YFCQ_ECOLI: Uncharacterized fimbrial-like protein YfcQ (yfcQ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 98% identity to see:SNSL254_A0220)

Predicted SEED Role

"Minor fimbrial subunit StfF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (158 amino acids)

>GFF71 Minor fimbrial subunit StfF (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKKIVLTMLMGGSLAAQAADNLKFHGTLISPPNCTINNDQTIDVKFGNLLINKIDGTRYA
QNVPYEITCDSTVRDETMAMTLTLSGSVSDFNPAAVNTSVAGLGIELRQNDQPFTLGSTI
TVNEQSIPVLKAIPVKKSGASLKEGGFDATATLQVDYQ