Protein Info for GFF7087 in Variovorax sp. SCN45

Annotation: oxidoreductase FAD/NAD(P)-binding domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 PF00111: Fer2" amino acids 19 to 93 (75 residues), 52.7 bits, see alignment E=6.7e-18 PF00970: FAD_binding_6" amino acids 118 to 207 (90 residues), 37.3 bits, see alignment E=5.9e-13 PF08030: NAD_binding_6" amino acids 217 to 273 (57 residues), 25.3 bits, see alignment E=2.9e-09 PF00175: NAD_binding_1" amino acids 218 to 317 (100 residues), 65.5 bits, see alignment E=1.3e-21

Best Hits

KEGG orthology group: K00529, ferredoxin--NAD+ reductase [EC: 1.18.1.3] (inferred from 59% identity to bbr:BB0727)

Predicted SEED Role

"oxidoreductase FAD/NAD(P)-binding domain protein"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.18.1.3

Use Curated BLAST to search for 1.18.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (338 amino acids)

>GFF7087 oxidoreductase FAD/NAD(P)-binding domain protein (Variovorax sp. SCN45)
LSHPVIPLIPLIPVTLLFADGVSQRVSVPRGGNLVEAATEAGLNLLTDCSNGQCGTCTAQ
LVSGTVELDEYDRAVLPDDDRASGTVLPCVCRVSTPCAIELPYDSTEALSEEPEPIPAEV
TAVEQVATEIVRLEVQVPEVVVFEPGQYVRIAPKGATFHRSYSMANVPGTDRLQFFVRLV
EGGAFSDWLAIAKVGDMVDLSAPHGTFFLRDEDRPRLFVAGGTGVAPFLSMLRSMIDNPH
AKRTTFVIGARTPGHLFAMEELKSLRERLEDVDLQIAVEQDAQDGCHTGYPTDLITKLGL
DPTTRVYLCGPPPMVEAGRRAAEAAGLKRADVLCERFT