Protein Info for PS417_03585 in Pseudomonas simiae WCS417

Annotation: kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 TIGR00154: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase" amino acids 5 to 280 (276 residues), 290.2 bits, see alignment E=1.1e-90 PF00288: GHMP_kinases_N" amino acids 68 to 145 (78 residues), 61.8 bits, see alignment E=5.9e-21 PF08544: GHMP_kinases_C" amino acids 208 to 256 (49 residues), 30 bits, see alignment 5.7e-11

Best Hits

Swiss-Prot: 98% identical to ISPE_PSEFS: 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (ispE) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K00919, 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC: 2.7.1.148] (inferred from 98% identity to pfs:PFLU0733)

Predicted SEED Role

"4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC 2.7.1.148)" in subsystem Isoprenoid Biosynthesis or polyprenyl synthesis (EC 2.7.1.148)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.148

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TUQ4 at UniProt or InterPro

Protein Sequence (283 amino acids)

>PS417_03585 kinase (Pseudomonas simiae WCS417)
MTGQTLTLPSPAKLNLMLHILGRREDGYHELQTLFQFLDYGDELTFAVRDDGVIKLHTEF
EGVPHDSNLIVKAAKKLQEQSGCRLGIDIWIDKILPMGGGIGGGSSNAATTLLGLNHLWQ
LGWDDDRLAALGLTLGADVPVFVRGHAAFAEGVGEKLTPEYPEEPWYVVLVPQVSVSTAE
IFSDPLLTRNSPPIKVRPVPKGNSRNDCLPVVARRYPEVRNALNLLGKFTEAKLTGTGSC
VFGGFPSKAEADKVSALLTETLTGFVAKGSNVSMLHRKLQSLL