Protein Info for GFF7037 in Variovorax sp. SCN45

Annotation: Uncharacterized MFS-type transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 32 to 53 (22 residues), see Phobius details amino acids 65 to 85 (21 residues), see Phobius details amino acids 91 to 107 (17 residues), see Phobius details amino acids 125 to 175 (51 residues), see Phobius details amino acids 207 to 230 (24 residues), see Phobius details amino acids 241 to 260 (20 residues), see Phobius details amino acids 272 to 300 (29 residues), see Phobius details amino acids 353 to 378 (26 residues), see Phobius details PF05977: MFS_3" amino acids 3 to 378 (376 residues), 115.7 bits, see alignment E=2.1e-37 PF07690: MFS_1" amino acids 4 to 339 (336 residues), 97.8 bits, see alignment E=6.4e-32

Best Hits

KEGG orthology group: None (inferred from 95% identity to vpe:Varpa_4214)

Predicted SEED Role

"MFS permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (400 amino acids)

>GFF7037 Uncharacterized MFS-type transporter (Variovorax sp. SCN45)
MHMWTARLFGTAASQMLLVAIGWHMYDLTGSAWDLGLVGLYQFVPALLLALLAGHIVDRH
HRGRIVAACFAVQGLVALVLLLAVMGKHDTRGLLLGLSLVLGAVRAFQMPAQQALTPLLV
PPTMLARAMAFSSAGMQGAIIGGPALGGLLFVAGMAVVYGASVACFAVACVLVLRLRYAY
TPAAREPVTLATVFAGVDFIWKRKPVLGAVSLDLFAVLLGGAVALLPIYAKDILHTGPWG
LGLLRGAPAVGALVMSIALTRRPVERHVGRTLLMAIALFGLCMVVFGISKSFIVSLIALA
VSGGADMVNVVIRQTLVQLETPDAMRGRVSAVNSIFIGASNQLGEFESGATAALLGPVGS
VVVGGVGTMVVALAWFRLFPSLAQRDRLTVAAPAVRPQSS