Protein Info for GFF703 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: TRAP-type C4-dicarboxylate transport system, small permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 182 transmembrane" amino acids 37 to 58 (22 residues), see Phobius details amino acids 70 to 88 (19 residues), see Phobius details amino acids 109 to 130 (22 residues), see Phobius details amino acids 150 to 169 (20 residues), see Phobius details PF04290: DctQ" amino acids 46 to 176 (131 residues), 94.5 bits, see alignment E=2.5e-31

Best Hits

KEGG orthology group: None (inferred from 64% identity to vap:Vapar_0835)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (182 amino acids)

>GFF703 TRAP-type C4-dicarboxylate transport system, small permease component (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSAPTDPSRDARTDADAATPDNPDDENTRVPLRIEDWLTVISMALLALITFGNVIARYFT
DQSFAWTEEFSIFLMIVLTLVASSAAVARHRHIRIEFFADAGSPRRRHLLALWGAMAMVL
LFLLMAGLSVRMVWDHYIYEEVSPGLGVPQWWYSMWLPILSLAIALRALGRFNRLRRAGE
QP