Protein Info for GFF7018 in Variovorax sp. SCN45

Annotation: ABC transporter, permease protein 1 (cluster 5, nickel/peptides/opines)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details transmembrane" amino acids 104 to 126 (23 residues), see Phobius details amino acids 138 to 169 (32 residues), see Phobius details amino acids 191 to 208 (18 residues), see Phobius details amino acids 249 to 273 (25 residues), see Phobius details amino acids 295 to 317 (23 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 7 to 108 (102 residues), 35.1 bits, see alignment E=1.3e-12 PF00528: BPD_transp_1" amino acids 120 to 326 (207 residues), 143.9 bits, see alignment E=4.9e-46

Best Hits

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 94% identity to vpe:Varpa_4438)

Predicted SEED Role

"Oligopeptide transport system permease protein OppB (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (328 amino acids)

>GFF7018 ABC transporter, permease protein 1 (cluster 5, nickel/peptides/opines) (Variovorax sp. SCN45)
MGMLPLLRHAASRLLQALGLVLAVVVLNFVLVHAAPGDPVETIAGASGGMSPELMAQLRT
QYGLDKSLPVQLAVYLGKVAQGDLGYSYFFNLPVTQMIGERLPATLLLVLSSVLLAFFAG
TALGVLSSRKPNGWLSQFITVLSLVGFAAPVFWLGIMLVILLASVFPILPVAGMRSIDST
GAGGFADMLDVAQHLVLPTLTLSLVYLAQYSRLARSSMLDVLGSDFIRTARAKGLADRVV
LYKHALRNALLPVVTVLGLQFGNVLAGAILVETVFNWPGLGRLAFESVLRRDYPTILGVL
LFSSIVVVVMNQLTDLCYRFIDPRIKAS