Protein Info for GFF700 in Variovorax sp. SCN45

Annotation: ABC transporter, permease protein 2 (cluster 4, leucine/isoleucine/valine/benzoate) / ABC transporter, ATP-binding protein 1 (cluster 4, leucine/isoleucine/valine/benzoate)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 648 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 36 to 56 (21 residues), see Phobius details amino acids 64 to 82 (19 residues), see Phobius details amino acids 88 to 108 (21 residues), see Phobius details amino acids 116 to 134 (19 residues), see Phobius details amino acids 163 to 182 (20 residues), see Phobius details amino acids 212 to 231 (20 residues), see Phobius details amino acids 238 to 255 (18 residues), see Phobius details amino acids 262 to 278 (17 residues), see Phobius details amino acids 284 to 303 (20 residues), see Phobius details amino acids 313 to 330 (18 residues), see Phobius details amino acids 336 to 359 (24 residues), see Phobius details PF02653: BPD_transp_2" amino acids 37 to 299 (263 residues), 143.9 bits, see alignment E=1.1e-45 PF00005: ABC_tran" amino acids 414 to 574 (161 residues), 98.3 bits, see alignment E=1.2e-31 PF12399: BCA_ABC_TP_C" amino acids 623 to 647 (25 residues), 40.9 bits, see alignment (E = 2.3e-14)

Best Hits

KEGG orthology group: K01995, branched-chain amino acid transport system ATP-binding protein K01998, branched-chain amino acid transport system permease protein (inferred from 72% identity to bxe:Bxe_A3708)

Predicted SEED Role

"Branched-chain amino acid transport ATP-binding protein LivG (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (648 amino acids)

>GFF700 ABC transporter, permease protein 2 (cluster 4, leucine/isoleucine/valine/benzoate) / ABC transporter, ATP-binding protein 1 (cluster 4, leucine/isoleucine/valine/benzoate) (Variovorax sp. SCN45)
VAKNPEKMKTSHLLLAIAGVAALLLFPIGIDNPYYIHLLETIMIYAILLFGLDIVVGYTG
QVSLGHAGLFGLGAYAAGVLVFKLSAPFWITVPFAIVFTAGFGALLALPALRVSGPYLAM
VTLAFGTIIQILINEMSFLTDGPMGIKLEKPSLFGHKLDDREYYWVVAVLMVLALVVVHR
ILRSHLGRAFEALRGSPVASDCMGVSVYRYKVYAFVISAGFAGLAGSLYAYSEQYISPNS
YNFELTVLFLLAVIMGGRKSRIGSMLGATIIVLLPKLLDDVVLFRYVSVGLAVAVLVAAV
VAIRRQRATPGQMAIPVVGSIALAGLAFWLDAMTDWRLSIFGVIMLFVIYYLQDGIVGFV
RKALNMRRPVASVDASDVDAAPADAVSTAAYAGGTEDVLEASGVLMQFGGLKALNNVDLR
IKRGTIHGLIGPNGSGKSTMMNVLTGIYVPTAGAISFGGRSLVGRTSADIALSGIARTFQ
NVQLFGEMTALQNVQVGLHHSFASNLLDVAAGTPRYRRESAAAVQRGLGLLKFVGLESFA
TEEARNLPYGKQRLLEIARALALDPQLLLLDEPAAGLTAPDIKELLGIIRKIREHGVTVI
LIEHHMDVVMSMCDTVSVLDFGQKIAEGEPARVQADEKVIEAYLGGGA