Protein Info for GFF7 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Probable secreted protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 128 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF13985: YbgS" amino acids 3 to 128 (126 residues), 210.5 bits, see alignment E=3.5e-67

Best Hits

Swiss-Prot: 100% identical to YBGS_SALTY: Uncharacterized protein YbgS (ybgS) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 99% identity to sec:SC0758)

Predicted SEED Role

"Probable secreted protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (128 amino acids)

>GFF7 Probable secreted protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKMTKLTTLLLTATLGLASGAALAAESNAQSSNGQANSAANAGQVAPDARQNVAPNDVNN
NDINTNGNTNSTMQHPDGSTMNHDGMTKDEEHKNTMCKDGRCPDINKKVETGNGVNNDVN
TKTDGTTQ