Protein Info for GFF6992 in Variovorax sp. SCN45

Annotation: Flagellum-specific ATP synthase FliI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 463 TIGR01026: ATPase, FliI/YscN family" amino acids 12 to 451 (440 residues), 539.7 bits, see alignment E=2.5e-166 PF02874: ATP-synt_ab_N" amino acids 28 to 100 (73 residues), 26.8 bits, see alignment E=9.2e-10 PF00006: ATP-synt_ab" amino acids 157 to 375 (219 residues), 286.2 bits, see alignment E=2.4e-89 PF18269: T3SS_ATPase_C" amino acids 383 to 452 (70 residues), 47.1 bits, see alignment E=2.6e-16

Best Hits

KEGG orthology group: K02412, flagellum-specific ATP synthase [EC: 3.6.3.14] (inferred from 84% identity to vap:Vapar_2274)

Predicted SEED Role

"Flagellum-specific ATP synthase FliI" in subsystem Flagellar motility or Flagellum

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (463 amino acids)

>GFF6992 Flagellum-specific ATP synthase FliI (Variovorax sp. SCN45)
VSVLAASREALRKTDLRRRIGWVREMQGLAIDALGPDAAVGELCRILVRTHTDPSAAAGR
VDEPAGVLAEVVGLKPGRVTLMPYGPAEGIAAGCEVHALGADSQIGVGPALLGRVIDCFG
EPLDGMPKPLTTQRRPLRGVPINPMKRPPIERVLETGIRSIDALLTLGQGQRVGIFAGSG
VGKSTLLGLLARHVKTQAGADGQGSINVIALIGERGREVREFIEKQLGVDGLARSVVVVA
TSDQPALARLRAAYAALAIAEHFRDGGSNVLLTMDSVTRFAMARREVGLSAGEPPTARGY
TPSVFAELPELCERCGTAPGGGSITALLTVLVEGDDLNEPVSDALRAILDGHIVLSRQLA
HRGHYPAIDVLKSVSRLMPELADDDERALAVAAVKQLAMLERNRQMIDIGAYEKGSNAEL
DRALTIEAGLQDWLQQSAGGVSRDEAIQRLRETLVPVMQGRSA