Protein Info for GFF697 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Heme A synthase, cytochrome oxidase biogenesis protein Cox15-CtaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 44 to 64 (21 residues), see Phobius details amino acids 114 to 135 (22 residues), see Phobius details amino acids 144 to 163 (20 residues), see Phobius details amino acids 169 to 188 (20 residues), see Phobius details amino acids 213 to 233 (21 residues), see Phobius details amino acids 287 to 308 (22 residues), see Phobius details amino acids 316 to 336 (21 residues), see Phobius details amino acids 342 to 364 (23 residues), see Phobius details PF02628: COX15-CtaA" amino acids 45 to 358 (314 residues), 252.8 bits, see alignment E=2.2e-79

Best Hits

KEGG orthology group: K02259, cytochrome c oxidase subunit XV assembly protein (inferred from 64% identity to rfr:Rfer_1688)

Predicted SEED Role

"Heme A synthase, cytochrome oxidase biogenesis protein Cox15-CtaA" in subsystem Biogenesis of cytochrome c oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (387 amino acids)

>GFF697 Heme A synthase, cytochrome oxidase biogenesis protein Cox15-CtaA (Hydrogenophaga sp. GW460-11-11-14-LB1)
MDTQPLYDLAPVARLMFLGVVIALGPLAWVWLRNRHAPPAHRLRVLTLITLFLTFDLVLF
GAFTRLTDSGLGCPDWPGCYGSVSPVGASSSIAAAQEAMPHGPVTFSKAWIEMIHRYLAT
AVGVLILVLSMVSWVERKRLSVSYVWPLVTLVWVCLQGAFGALTVTMKLFPAIVTLHLLG
GLGLLALLRAQSVGYALAEPGHAGRVALPGRLRWALGAVLLLLWLQIALGGWVSTNYAVL
VCGEFPTCQGSWWPAMNFREGFTLWRELGQNHTGDLITFPALTAIHYVHRLMAYVVLAAM
IWLGWRLWSVAGMRAAARALLLLAAWQFASGLTNVVLDWPLLAAVGHTGGAAALVIVLTG
ALCATRRADQRDAAPSATSLHLSSPIR