Protein Info for GFF6960 in Variovorax sp. SCN45

Annotation: Type cbb3 cytochrome oxidase biogenesis protein CcoG, involved in Cu oxidation

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 475 transmembrane" amino acids 41 to 60 (20 residues), see Phobius details amino acids 89 to 110 (22 residues), see Phobius details amino acids 162 to 180 (19 residues), see Phobius details amino acids 200 to 216 (17 residues), see Phobius details amino acids 344 to 364 (21 residues), see Phobius details TIGR02745: cytochrome c oxidase accessory protein CcoG" amino acids 39 to 471 (433 residues), 508.2 bits, see alignment E=1e-156 PF12801: Fer4_5" amino acids 95 to 133 (39 residues), 34.3 bits, see alignment 7.4e-12 PF13746: Fer4_18" amino acids 217 to 322 (106 residues), 138.9 bits, see alignment E=3.3e-44 PF00037: Fer4" amino acids 269 to 283 (15 residues), 22.7 bits, see alignment (E = 2.6e-08) PF11614: FixG_C" amino acids 358 to 474 (117 residues), 106.3 bits, see alignment E=4.8e-34

Best Hits

KEGG orthology group: None (inferred from 85% identity to vap:Vapar_2822)

Predicted SEED Role

"Type cbb3 cytochrome oxidase biogenesis protein CcoG, involved in Cu oxidation" in subsystem Biogenesis of cbb3-type cytochrome c oxidases or Terminal cytochrome C oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (475 amino acids)

>GFF6960 Type cbb3 cytochrome oxidase biogenesis protein CcoG, involved in Cu oxidation (Variovorax sp. SCN45)
MTRKIIPIASSNPGAGGGEEVGLYEATKKIYPRSVCGMFARWRWAMVLLTQLVFYGMPWV
EWGGRQMVLFDLAARRFYIFGLVLYPQDLIYLSGLLVISALSLFLFTTVAGRLWCGYACP
QTVYTEIFMWVEQRIEGNRVARMRLDTEPMSLEKLVKKWFKHIVWIGIAMWTGFTFVGYF
TSIRELGMAFLQTQMGSWEVFWVFFYGFATYGNAGFMREQVCKYMCPYARFQSAMFDGDT
LIVTYDPGRGEPRAPRRKGPDPRTMALGDCIDCGLCVQVCPTGIDIRKGLQYECIGCGVC
ADACDTVMQKMAYAPGLIRYDTQNGMEAGWSRRQLLRRVLRPRVLVYTAILALLVAALLA
SLVMRTPLKVDVVRDRASLARIAEGGRLENVYRLQIMNATEQPQQYLIAASGLDGLSVSP
DQPVGVEAAQSRWVAVRLQVPYGSAPPGSHTVHFSIREEGSGAQVSEKAAFLVPR