Protein Info for GFF6952 in Variovorax sp. SCN45

Annotation: Metallo-beta-lactamase family protein, RNA-specific

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 PF00753: Lactamase_B" amino acids 16 to 201 (186 residues), 59.1 bits, see alignment E=1.2e-19 PF12706: Lactamase_B_2" amino acids 24 to 224 (201 residues), 41.6 bits, see alignment E=2.1e-14 PF10996: Beta-Casp" amino acids 247 to 365 (119 residues), 118.1 bits, see alignment E=6.8e-38 PF07521: RMMBL" amino acids 380 to 442 (63 residues), 62.5 bits, see alignment E=5.9e-21

Best Hits

KEGG orthology group: K07576, metallo-beta-lactamase family protein (inferred from 61% identity to adk:Alide2_3371)

Predicted SEED Role

"Metallo-beta-lactamase family protein, RNA-specific" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (450 amino acids)

>GFF6952 Metallo-beta-lactamase family protein, RNA-specific (Variovorax sp. SCN45)
MRIDFLGGTGTVTGSKYLLTHEGRRLMVDCGLFQGLKQLRLRNWDALPVEPSSIDAVFLT
HAHMDHSGFIPRLVRLGFRGKVHCSAATRELCELLLPDSGRLQEEDAAYANRHGHSKHEP
ALPLYTEEEARAALERFEPVPFGQECAPWPGWSWQLRRAGHILGAGSLRVGWEGASILFS
GDLGRSGDLLMRPPEVVDPADYVVVESTYGDRGHPATDTLAELAGVINRTAARGGIVLIP
AFAIGRAQTLLHCIQLLRQARRIPDMPVYLNSPMAADATRIYRRYPDEHRLSARQCTEMQ
GQTIIVNTIEESRRLNALDFPSIIVSASGMATGGRVLHHLKAYAPDARNTILFAGFQAAG
TRGAAMMAGADAVKIHGAYVPVRAEIANLESLSAHADRDELLAWLDWQKAPRRVFVTHGE
PVAADALRLAIEERHDWPCTVPEYRESREL