Protein Info for GFF6950 in Variovorax sp. SCN45

Annotation: Acetoacetyl-CoA reductase (EC 1.1.1.36)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01829: acetoacetyl-CoA reductase
  • amino acids 2 to 238 (237 residues), 311.7 bits, E=1.9e-97
• PF00106: adh_short
  • amino acids 2 to 188 (187 residues), 190.8 bits, E=3.8e-60
• PF08659: KR
  • amino acids 4 to 164 (161 residues), 64 bits, E=3.6e-21
• PF13561: adh_short_C2
  • amino acids 11 to 235 (225 residues), 192.4 bits, E=1.9e-60

Best Hits

Swiss-Prot: 57% identical to PHAB_RHIME: Acetoacetyl-CoA reductase (phaB) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00023, acetoacetyl-CoA reductase [EC: 1.1.1.36] (inferred from 69% identity to bxe:Bxe_B0354)

MetaCyc: 58% identical to (R)-3-hydroxybutyryl-CoA dehydrogenase (Cereibacter sphaeroides)
Acetoacetyl-CoA reductase. [EC: 1.1.1.36]

Predicted SEED Role

"Acetoacetyl-CoA reductase (EC 1.1.1.36)" in subsystem Acetyl-CoA fermentation to Butyrate or Polyhydroxybutyrate metabolism or Serine-glyoxylate cycle (EC 1.1.1.36)

MetaCyc Pathways

• acetyl-CoA fermentation to butanoate (6/7 steps found)
• polyhydroxybutanoate biosynthesis (3/3 steps found)
• (2S)-ethylmalonyl-CoA biosynthesis (3/4 steps found)
• (R)- and (S)-3-hydroxybutanoate biosynthesis (engineered) (3/5 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (18/26 steps found)
• 4-oxopentanoate degradation (3/9 steps found)
• ethylmalonyl-CoA pathway (4/11 steps found)

KEGG Metabolic Maps

• Butanoate metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.36

Use Curated BLAST to search for 1.1.1.36

Protein Sequence (239 amino acids)

>GFF6950 Acetoacetyl-CoA reductase (EC 1.1.1.36) (Variovorax sp. SCN45)
MRVALVTGGTSGIGAATAEALQAAGYRVAVTFANHAEPAQAFAARTGIPAFGWNVADAAA
CQAGVAHVETELGPVDVLVNNAGITRDTMLHKMSAQQWREVLDVNLGGCFNMCRAVIGGM
RERRFGRIVNMGSVNGLSGQAGQANYAATKAGLAGFTKSLALEGASRNITANVVAPGYTD
TPMVEAVAPEVMARILSDIPAGRLATPAEIARGVVFLVADESGFINGITLSINGGKYMA