Protein Info for GFF694 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Predicted membrane fusion protein (MFP) component of efflux pump, membrane anchor protein YbhG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF16576: HlyD_D23" amino acids 42 to 318 (277 residues), 60.1 bits, see alignment E=3e-20 PF13533: Biotin_lipoyl_2" amino acids 43 to 90 (48 residues), 47.9 bits, see alignment 1.3e-16 PF13437: HlyD_3" amino acids 205 to 290 (86 residues), 43.5 bits, see alignment E=6.7e-15

Best Hits

Swiss-Prot: 100% identical to YBHG_SALTY: UPF0194 membrane protein YbhG (ybhG) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K01993, HlyD family secretion protein (inferred from 99% identity to seg:SG0797)

Predicted SEED Role

"Predicted membrane fusion protein (MFP) component of efflux pump, membrane anchor protein YbhG"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (331 amino acids)

>GFF694 Predicted membrane fusion protein (MFP) component of efflux pump, membrane anchor protein YbhG (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKKPVVIGLAIAAIVAVIAGGTWWYQSRQDDGLTLYGNVDIRTVNISFRVGGRLASLNVD
EGDTIKAGQVLGELDHAPYENALMQAKAGVSVAQAQYDLMLAGYRDEEIAQAAAAVRQAQ
AAYDYAQNFYNRQQGLWKSRTISANDLENARSSRDQAQATLKSAQDKLSQYRTGNREQDI
AQAKASLEQAKAQLAQAQLDLQDTTLIAPANGTLLTRAVEPGSMLNAGSTVLTLSLTRPV
WVRAYVDERNLSQTQPGRDILLYTDGRPDKPYHGKIGFVSPTAEFTPKTVETPDLRTDLV
YRLRIIVTDADDALRQGMPVTVKFNDEARHE