Protein Info for GFF6936 in Variovorax sp. SCN45

Annotation: ABC transporter, ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 PF00005: ABC_tran" amino acids 33 to 181 (149 residues), 116.6 bits, see alignment E=6.6e-38

Best Hits

Swiss-Prot: 39% identical to LOLD_CHRSD: Lipoprotein-releasing system ATP-binding protein LolD (lolD) from Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768)

KEGG orthology group: K02003, (no description) (inferred from 70% identity to hse:Hsero_2386)

MetaCyc: 36% identical to cystine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-290 [EC: 7.4.2.12]; 7.4.2.12 [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]

Predicted SEED Role

"Methionine ABC transporter ATP-binding protein" in subsystem Methionine Biosynthesis or Methionine Degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (238 amino acids)

>GFF6936 ABC transporter, ATP-binding protein (Variovorax sp. SCN45)
MNTPDATRGHEAISAFGLTKYFGENETRVTAVDHVDFVANFGEMVFLVGPSGSGKTTFLS
MVSGILRPDEGTVNVKGADIWSMDKDALADFRLNTIGFVFQDYHLFPRLTTAENVAIPLI
LKHLDWDASIAQARKYLEVVGLRERGDIVPVKLSGGEQQRVAIARAIVGSPEILILDEPT
ASLDGDTGRMILAFVKDRILDAGRCILIVTHDARINEYADRIVHMEDGRITGLDKGTE