Protein Info for GFF6924 in Variovorax sp. SCN45

Annotation: protein of unknown function DUF485

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 105 transmembrane" amino acids 25 to 46 (22 residues), see Phobius details amino acids 58 to 82 (25 residues), see Phobius details PF04341: DUF485" amino acids 11 to 97 (87 residues), 114.1 bits, see alignment E=1.2e-37

Best Hits

KEGG orthology group: None (inferred from 66% identity to pde:Pden_4212)

Predicted SEED Role

"Putative membrane protein, clustering with ActP" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (105 amino acids)

>GFF6924 protein of unknown function DUF485 (Variovorax sp. SCN45)
MEDDMAARIAAHPKYQQLKRRRDRFGWTLAVLMLAAYYGFVLLVAFDKEFLARRIGDGVM
TLGMPLGFGVIVFTVAITSYYVRRANAEFDALSDAVVKAVKGNKP