Protein Info for GFF6908 in Variovorax sp. SCN45

Annotation: putative membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 transmembrane" amino acids 6 to 31 (26 residues), see Phobius details amino acids 42 to 60 (19 residues), see Phobius details amino acids 72 to 92 (21 residues), see Phobius details amino acids 97 to 118 (22 residues), see Phobius details amino acids 124 to 149 (26 residues), see Phobius details amino acids 162 to 181 (20 residues), see Phobius details amino acids 187 to 207 (21 residues), see Phobius details amino acids 216 to 235 (20 residues), see Phobius details PF01925: TauE" amino acids 11 to 231 (221 residues), 89.4 bits, see alignment E=1.5e-29

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 66% identity to sen:SACE_0663)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (237 amino acids)

>GFF6908 putative membrane protein (Variovorax sp. SCN45)
VSAQHLFLVSIAVLIAAFVQGATGVGFALIAAPVIGIVRPDLLPVCVLVLMLPLNFYVMW
RERGAIDRVGASWITGGRMLGTIGGLWVLAALSASHLSLFVGVSTIAAALVTLMMPAFSP
GRSAFVAAGLVTGVTETATGIGGPPLALVYQHQPAPSMRSTIALCFLVGELVSLVTLMVA
GRIDGSQLQAAAQLLPALVVGAVLSRVVHRRINGRVLRVFVQVFAIVSGAALLLHSF