Protein Info for GFF6904 in Variovorax sp. SCN45

Annotation: Zinc-type alcohol dehydrogenase-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02817: zinc-binding alcohol dehydrogenase family protein
  • amino acids 2 to 336 (335 residues), 523.8 bits, E=1.1e-161
• PF08240: ADH_N
  • amino acids 29 to 88 (60 residues), 55.3 bits, E=1e-18
• PF00107: ADH_zinc_N
  • amino acids 160 to 246 (87 residues), 44.9 bits, E=1.7e-15
• PF13602: ADH_zinc_N_2
  • amino acids 193 to 333 (141 residues), 61.3 bits, E=2.8e-20

Best Hits

Swiss-Prot: 38% identical to ZDH1_STAAR: Zinc-type alcohol dehydrogenase-like protein SAR2277 (SAR2277) from Staphylococcus aureus (strain MRSA252)

KEGG orthology group: None (inferred from 95% identity to vpe:Varpa_0754)

Predicted SEED Role

"Bifunctional protein: zinc-containing alcohol dehydrogenase; quinone oxidoreductase ( NADPH:quinone reductase) (EC 1.1.1.-); Similar to arginate lyase" (EC 1.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Benzoate degradation via CoA ligation
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of type II polyketide products
• Biosynthesis of unsaturated fatty acids
• Bisphenol A degradation
• Butanoate metabolism
• C21-Steroid hormone metabolism
• Fructose and mannose metabolism
• Glycine, serine and threonine metabolism
• Insect hormone biosynthesis
• Linoleic acid metabolism
• Nucleotide sugars metabolism
• Polyketide sugar unit biosynthesis
• Retinol metabolism
• Tetrachloroethene degradation

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-

Use Curated BLAST to search for 1.1.1.-

Protein Sequence (336 amino acids)

>GFF6904 Zinc-type alcohol dehydrogenase-like protein (Variovorax sp. SCN45)
MKAVGYYQPLPIDNPESLQDIELPAPAAGPRDLLVRVKAVSVNPVDTKVRKNAAPEAGQA
KVLGWDAVGTVEAVGSGVRNFKIGDRVYYAGSIIRPGANAELHAVDERIAALAPKSLDDA
QAAALPLTTITAYELLFDRLRVPKDGGEGQTLLITGGAGGVGSILIQLARQLTRLRVVAT
ASRAETREWCLALGAHTVIDHSKPLAAELKAAGIGEVDMVASLTQTEQHYAQIIESLKPQ
GQLAVIDDMKVLDAMPLKTKCISLHWEMMFTRSRFETPDIAEQGALLAEVAALVDAGRIR
TTANASFGTINAANLKKAHALIESGKAQGKVVLAGF