Protein Info for GFF690 in Sphingobium sp. HT1-2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 210 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 24 to 24 (1 residues), see Phobius details amino acids 39 to 58 (20 residues), see Phobius details amino acids 69 to 88 (20 residues), see Phobius details amino acids 108 to 133 (26 residues), see Phobius details amino acids 139 to 161 (23 residues), see Phobius details amino acids 167 to 192 (26 residues), see Phobius details PF01914: MarC" amino acids 7 to 198 (192 residues), 50.8 bits, see alignment E=7.3e-18

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (210 amino acids)

>GFF690 hypothetical protein (Sphingobium sp. HT1-2)
MNDLSFVLVIFFVTLGPIKVIAAFAQLTSQLPDGERRALALRSTLIATAVGFLILFIGDN
LRQNWQIASPDLLLTGGVLLLIGALEAVKNAQHAPAPDAPPTSAKGLAMSPVTFPIIITP
YGIVALLLFAAVAGDTRTFLTGVFGIFLGMMVADFLAMIFARQLLGFIHAGTLMAFGWMI
AVLQAALAIHAIMSGLQQYGVVPGPLPVVP