Protein Info for GFF69 in Xanthobacter sp. DMC5

Annotation: Tol-Pal system protein TolB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 468 transmembrane" amino acids 36 to 55 (20 residues), see Phobius details TIGR02800: Tol-Pal system beta propeller repeat protein TolB" amino acids 56 to 464 (409 residues), 465.3 bits, see alignment E=9.6e-144 PF04052: TolB_N" amino acids 63 to 164 (102 residues), 112 bits, see alignment E=3e-36 PF07676: PD40" amino acids 275 to 308 (34 residues), 28.4 bits, see alignment 2.4e-10 amino acids 317 to 352 (36 residues), 41.3 bits, see alignment 2.2e-14 amino acids 361 to 392 (32 residues), 18.6 bits, see alignment (E = 2.9e-07) amino acids 404 to 440 (37 residues), 20.2 bits, see alignment 9.4e-08

Best Hits

Swiss-Prot: 69% identical to TOLB_BRADU: Tol-Pal system protein TolB (tolB) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K03641, TolB protein (inferred from 92% identity to xau:Xaut_3056)

Predicted SEED Role

"tolB protein precursor, periplasmic protein involved in the tonb-independent uptake of group A colicins" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (468 amino acids)

>GFF69 Tol-Pal system protein TolB (Xanthobacter sp. DMC5)
MTRSGRPENSQRPLDDVHAGASPLGGTLARGLGRRAFLMTGMAAGAAGILHGGFGAAHAQ
AARIEITPGAFKPIPIAITDLLGEPELGRNISGVITSDLRRCGLFAPIDPKAFVEQITNP
DTPRFQDWRVINAQALLTGRVTRQADGRVQVVFRLWDVFAGQQLAAQQFVAQPENWRRIA
HIVADAIYEKMTGEKGYFDTRIVFVDESGPKERRIKRLAIMDQDGANVSYLTRGDSLVLT
PRFSPTSQEITYMSYGQGDPKVFLLNIETGQREIVGNFPGMSFSPRFAPDGQKVIMSLQQ
GGNSNIFVMDLRSRATTRLTDTAAIDTAPCYSPDGRQICFESDRGGTSQIYVMNADGSGA
KRISFGNARYSTPVWSPKGDWIAYTRQAEGRFAIGVMRTDGSGERVLTEGYHNEGPTFCP
NGRVLMFFRDPGGASGPSLYTVDVTGYNEQRLPTPSYGSDPAWSPLRS