Protein Info for GFF69 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Uncharacterized protein YadU in stf fimbrial cluster

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF11245: DUF2544" amino acids 50 to 279 (230 residues), 451.4 bits, see alignment E=4.2e-140

Best Hits

Swiss-Prot: 100% identical to YADU_SALTY: Uncharacterized protein YadU (yadU) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 100% identity to stm:STM0201)

Predicted SEED Role

"Uncharacterized protein YadU in stf fimbrial cluster"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (279 amino acids)

>GFF69 Uncharacterized protein YadU in stf fimbrial cluster (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKIIRTLFLLLIAVYGSSVVAKPMLKATFSSTTMYYGIGPNSDKSIVAEVTIATPEGVYY
GSWNLSGHRKGETLTADSWSGPEPAPKVVLKDFDNTVSRSACKNLPSNWRGCGSFTLEIT
VQSDDYGCPWLASSHIVATTFITNETYSPPDTRSSVCPKVPVDTFDISWDANVSKQKTTL
MLDATGGTVNRTLHTYLMEGGKLCDGSKFDNRGAYCRFVSSGITLNVLGCDQSSVTTSAV
DHPITDVELHDINVAVNTRNIGSGQFTSTCSFQYIIDEL