Protein Info for GFF6888 in Variovorax sp. SCN45

Annotation: Permease of the drug/metabolite transporter (DMT) superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 44 to 65 (22 residues), see Phobius details amino acids 77 to 97 (21 residues), see Phobius details amino acids 103 to 124 (22 residues), see Phobius details amino acids 131 to 150 (20 residues), see Phobius details amino acids 162 to 181 (20 residues), see Phobius details amino acids 193 to 213 (21 residues), see Phobius details amino acids 221 to 242 (22 residues), see Phobius details amino acids 254 to 272 (19 residues), see Phobius details amino acids 278 to 295 (18 residues), see Phobius details PF00892: EamA" amino acids 10 to 139 (130 residues), 51.9 bits, see alignment E=5e-18 amino acids 162 to 292 (131 residues), 54.9 bits, see alignment E=6e-19

Best Hits

KEGG orthology group: None (inferred from 88% identity to vpe:Varpa_0765)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (327 amino acids)

>GFF6888 Permease of the drug/metabolite transporter (DMT) superfamily (Variovorax sp. SCN45)
MKPGIKDETLGMWLGVVGVAMFAITLPMTRLAIGSQESPQLSPWFVTLGRAALAGVLSAI
FLLVTRSPRPAAHQWKPLGVAVLGNAIGFPLLLAYALRVVTASHAAVVTALLPLVTAAVA
AWVLHQRARLGFWLCAVAGSLLVVAFSVLRASQTGHGFGFEWADLLLVGAVIAASFGYIY
GAQVTPSLGAERVICWVCVMALPVTLPATLALWPRQPVATSAWLGFVYVGMFSMWIGFFA
WYRGLALGGALRVSQTQLLQPFLSILASIPLLGEPLDVVTLGFAIAVVATVVVGKRLSQP
ASPAPPTKAAAPKMAAAAAGKAGPRGR