Protein Info for GFF6876 in Variovorax sp. SCN45

Annotation: Aminotransferase, DegT/DnrJ/EryC1/StrS family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 PF01041: DegT_DnrJ_EryC1" amino acids 15 to 362 (348 residues), 407.3 bits, see alignment E=6.9e-126 PF00155: Aminotran_1_2" amino acids 37 to 304 (268 residues), 29.3 bits, see alignment E=5.3e-11

Best Hits

Swiss-Prot: 54% identical to ERBS_SACEN: Erythromycin biosynthesis sensory transduction protein EryC1 (eryC1) from Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)

KEGG orthology group: K00837, [EC: 2.6.1.-] (inferred from 58% identity to gur:Gura_3190)

MetaCyc: 54% identical to dTDP-3-oxo-3,4,6-trideoxy-alpha-D-glucopyranose transaminase monomer (Saccharopolyspora erythraea NRRL 2338)
RXN-12768 [EC: 2.6.1.106]

Predicted SEED Role

"Aminotransferase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.-

Use Curated BLAST to search for 2.6.1.- or 2.6.1.106

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (366 amino acids)

>GFF6876 Aminotransferase, DegT/DnrJ/EryC1/StrS family (Variovorax sp. SCN45)
MIPFFDIHAGHAEMADDFTQAFSKVMKSGHVIMGGELVAFENEFAAYCGAKHCIGVGNGL
DALALTLRARGIKAGDEVLVPSQTFIATWLGVSMVGATPVPVEIDPATYLLDPARIKEKL
TSRTKAIIPVHLYGLPAAMDAINEIARPLGIFVFEDAAQAHGATHNGKRTGVLGDAAAFS
FYPTKNLGAMGDAGAVVTNDDALAGELRMLRNYGSSQKYVHEVAGVNSRLDELQAALLRT
KLGRLDAWNEQRRALAARYSEGLRGVGDIRIPHVPSDSTHVYHLYVISTGRRAELSAHLT
AQGIQTLVHYPIPPHVQGAYAELGLPADSLPLATAAANETLSLPIWPQMQPEQVDAVVAQ
IRKFFA