Protein Info for PS417_03490 in Pseudomonas simiae WCS417

Annotation: type III secretion system protein SsaR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 transmembrane" amino acids 9 to 40 (32 residues), see Phobius details amino acids 53 to 73 (21 residues), see Phobius details amino acids 140 to 156 (17 residues), see Phobius details amino acids 162 to 181 (20 residues), see Phobius details amino acids 192 to 214 (23 residues), see Phobius details TIGR01102: type III secretion apparatus protein, YscR/HrcR family" amino acids 11 to 212 (202 residues), 269.1 bits, see alignment E=1.3e-84 PF00813: FliP" amino acids 16 to 212 (197 residues), 208.3 bits, see alignment E=5.6e-66

Best Hits

Swiss-Prot: 68% identical to HRPW_PSESY: Harpin secretion protein HrpW (hrpW) from Pseudomonas syringae pv. syringae

KEGG orthology group: K03226, type III secretion protein SctR (inferred from 87% identity to pfs:PFLU0715)

Predicted SEED Role

"Type III secretion inner membrane protein (YscR,SpaR,HrcR,EscR,homologous to flagellar export components)" in subsystem Type III secretion systems, extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TZD8 at UniProt or InterPro

Protein Sequence (217 amino acids)

>PS417_03490 type III secretion system protein SsaR (Pseudomonas simiae WCS417)
MTFQGIDPLILALFVGALALMPMLLIICTSFLKIVIVLMITRNAIGVQQVPPSMAVNGIA
LAATLFIMAPVGYEIAEGIKASPVDTSSVINFLQTGREAIQPLRAFMLRNVDPDVLTHLL
ENTARLWPAKMAQEVQREDLILLVPAFVLSQLQAGFEIGFLIYIPFIVIDLIVSNLLLAL
GMQMVSPMTISLPLKLLLFVMVSGWSRLLDSLFLSYL