Protein Info for GFF686 in Sphingobium sp. HT1-2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 transmembrane" amino acids 105 to 125 (21 residues), see Phobius details amino acids 252 to 269 (18 residues), see Phobius details amino acids 281 to 300 (20 residues), see Phobius details amino acids 306 to 324 (19 residues), see Phobius details amino acids 344 to 363 (20 residues), see Phobius details PF12412: DUF3667" amino acids 76 to 119 (44 residues), 61.8 bits, see alignment 1.8e-21

Best Hits

Predicted SEED Role

"FIG00636829: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (364 amino acids)

>GFF686 hypothetical protein (Sphingobium sp. HT1-2)
MTGEIEAAGDAITGGMLARAVEPGHGEAHEAGHGACLNCGTAVTGNYCPECGQAAHLHRS
FAAIGHDLAHGVLHFEGKIFTTLPELALRPGQLTRRYIHGERAKFVSPFALFLFSAFLMY
AIFSLTSHHGPEGTRNQVKMNSEAIAELKKEEEKADARIAKVQAQLAEPGISASRRETLQ
EKLKDAQDERKGLSLASGLTDALAGDNVDKAVDKTVDKGLNKGIAKTVGKAMSAAAKDPE
FAYYKLKANAYKFSWLLIVISLPFLWLLFPFSRRFKMYDHAIYVTYSIAFMSLLFSLSMI
LTAVGITHGLVTVVLLLFAAWHMYRQFKDAYQLSRSGTLLRLPLLYGFACASLSLFFAFL
MMMG