Protein Info for GFF6828 in Variovorax sp. SCN45

Annotation: CDP-diacylglycerol--serine O-phosphatidyltransferase (EC 2.7.8.8)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 transmembrane" amino acids 21 to 45 (25 residues), see Phobius details amino acids 51 to 68 (18 residues), see Phobius details amino acids 89 to 109 (21 residues), see Phobius details amino acids 115 to 133 (19 residues), see Phobius details amino acids 154 to 180 (27 residues), see Phobius details amino acids 186 to 204 (19 residues), see Phobius details PF01066: CDP-OH_P_transf" amino acids 19 to 175 (157 residues), 86.9 bits, see alignment E=9.7e-29

Best Hits

Swiss-Prot: 45% identical to PSS_SCHPO: CDP-diacylglycerol--serine O-phosphatidyltransferase (pps1) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: K00998, phosphatidylserine synthase [EC: 2.7.8.8] (inferred from 90% identity to vap:Vapar_3234)

Predicted SEED Role

"CDP-diacylglycerol--serine O-phosphatidyltransferase (EC 2.7.8.8)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.8

Use Curated BLAST to search for 2.7.8.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (212 amino acids)

>GFF6828 CDP-diacylglycerol--serine O-phosphatidyltransferase (EC 2.7.8.8) (Variovorax sp. SCN45)
MTTPSPAPARKHFSMIREFHLADAFTLGNAACGVGAVFLAMAFMASQSLTQFLWAAALAP
AAFIFDVFDGRIARWRQTQSALGRELDSLADIISFGVAPAALGFAAGLNGGWDCVLLVYF
VCCGVSRLARYNVTAEALSAGADKVKYFEGTPIPTSVMLVAVLACAAWQGGIGASVWGGA
WLIGPWQLHPLVLMFALSGTLMISKTLRIPKF