Protein Info for PS417_03465 in Pseudomonas simiae WCS417

Annotation: type III secretion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 transmembrane" amino acids 133 to 152 (20 residues), see Phobius details PF16697: Yop-YscD_cpl" amino acids 5 to 93 (89 residues), 65.3 bits, see alignment E=7.3e-22 PF00498: FHA" amino acids 23 to 56 (34 residues), 22.1 bits, see alignment 2.6e-08 PF21934: Yop-YscD_ppl_3rd" amino acids 176 to 239 (64 residues), 56.1 bits, see alignment E=3.8e-19

Best Hits

Predicted SEED Role

"type III secretion protein HrpQ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TXN4 at UniProt or InterPro

Protein Sequence (299 amino acids)

>PS417_03465 type III secretion protein (Pseudomonas simiae WCS417)
MFELRVLDGRHQGAALPLFGEQWSIGAHADADLVLNDPGIAEQHARLRLVDSNWSVQAEA
GLLQDADGQVLAQIAHLGLNVTFSVGNVRLCVTLADEPWPQAPAPALAVSPRISEPVPVL
KLSAISQAQQKRLITLVLVVTVIFIVVGMASTGKPEAQASLMPPVVQKHELASPFEVRQQ
LLKMLGERELSQRVSLQVVNGQVALNGDVSQDDVELVARMLSRFGEQFDSAVPVISRVRV
RDGTLPFKIVQIVGGPNGHVVLEEGSRLFVGDEVDGLRLVLIDNSKVVFDGEQRYEVRW