Protein Info for PS417_00345 in Pseudomonas simiae WCS417

Annotation: copper-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF00578: AhpC-TSA" amino acids 51 to 122 (72 residues), 31.8 bits, see alignment E=1.2e-11 PF02630: SCO1-SenC" amino acids 56 to 186 (131 residues), 134.3 bits, see alignment E=2.7e-43

Best Hits

Swiss-Prot: 49% identical to SCOP_PSEST: Putative copper-binding protein (scoP) from Pseudomonas stutzeri

KEGG orthology group: K07152, (no description) (inferred from 98% identity to pfs:PFLU0067)

Predicted SEED Role

"Cytochrome oxidase biogenesis protein Sco1/SenC/PrrC, putative copper metallochaperone" in subsystem Biogenesis of cytochrome c oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TV52 at UniProt or InterPro

Protein Sequence (211 amino acids)

>PS417_00345 copper-binding protein (Pseudomonas simiae WCS417)
MTRTQKTVFILVALVALIMGLTVNKVLSGKGQGDPTALIDAGIILLPQSRQLPPVTMTNQ
DGQPVVVNELKGKWSLLFFGYTFCPDICPTTLAQLRQIKSELPKDVVDKLQVILVSVDPN
RDTPTQLKQYLGYFDPQFQGLTGANVEEVQKVSNAVSIPFIPADTSKPNYTVDHSGNLAL
IGPDGTQRGFIRAPLNNQKLVAQLPGLLLRK