Protein Info for GFF68 in Variovorax sp. SCN45

Annotation: UDP-glucose 4-epimerase (EC 5.1.3.2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04321: RmlD_sub_bind
  • amino acids 5 to 163 (159 residues), 49.5 bits, E=1.3e-16
• TIGR01179: UDP-glucose 4-epimerase GalE
  • amino acids 5 to 336 (332 residues), 412.1 bits, E=7e-128
• PF08659: KR
  • amino acids 5 to 137 (133 residues), 31.1 bits, E=8.7e-11
• PF01370: Epimerase
  • amino acids 6 to 255 (250 residues), 189.4 bits, E=2.8e-59
• PF02719: Polysacc_synt_2
  • amino acids 6 to 185 (180 residues), 45.2 bits, E=2.9e-15
• PF00106: adh_short
  • amino acids 6 to 175 (170 residues), 32.4 bits, E=2.6e-11
• PF16363: GDP_Man_Dehyd
  • amino acids 7 to 326 (320 residues), 186.4 bits, E=4e-58
• PF01073: 3Beta_HSD
  • amino acids 7 to 162 (156 residues), 68.7 bits, E=1.8e-22

Best Hits

Swiss-Prot: 56% identical to GALE_YERPE: UDP-glucose 4-epimerase (galE) from Yersinia pestis

KEGG orthology group: K01784, UDP-glucose 4-epimerase [EC: 5.1.3.2] (inferred from 74% identity to vpe:Varpa_2874)

MetaCyc: 58% identical to UDP-glucose 4-epimerase (Bacillus subtilis subtilis 168)
UDP-N-acetylglucosamine 4-epimerase. [EC: 5.1.3.7]; UDP-glucose 4-epimerase. [EC: 5.1.3.7, 5.1.3.2]

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

• colanic acid building blocks biosynthesis (11/11 steps found)
• UDP-α-D-galactose biosynthesis (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis I (1/1 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• UDP-α-D-galactofuranose biosynthesis (1/2 steps found)
• D-galactose degradation I (Leloir pathway) (3/5 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (4/7 steps found)
• D-galactose detoxification (1/3 steps found)
• stachyose degradation (2/7 steps found)
• UDP-sugars interconversion (2/9 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (12/33 steps found)
• mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (1/18 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Galactose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 5.1.3.2 or 5.1.3.7

Protein Sequence (372 amino acids)

>GFF68 UDP-glucose 4-epimerase (EC 5.1.3.2) (Variovorax sp. SCN45)
MPHAKILVTGGAGFIGSHTCVALIAAGYQPVVLDTLVNSDARSLQRVGCITGLQPLLLPC
DVRDAAALDRVFAEHAIEAVVHLAGLKAVGESVADPVAYYDVNLAGTLALVQAMGRAGVR
TLVFSSSATVYGDAQRSPIPETAPYAAVNPYGRTKAMVENLLADLAHADARWGIACLRYF
NPVGAHESGLLGERPHGPPANLMPYISQVAAGEREYLMVHGADYATIDGTGVRDYVHVMD
VAEGHVAALRHVAREPGILMTNLGTGRGASVLEVVCAFERASGRRIALRIGPRRPGDAPA
YWADARNAQARLGWCARRDLDQMCADCWRWQAANPHGFDDPVPPLQAQAQPPWLPADLQI
FHTTSNLGHSNA