Protein Info for GFF68 in Methylophilus sp. DMC18

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 168 signal peptide" amino acids 12 to 15 (4 residues), see Phobius details amino acids 34 to 34 (1 residues), see Phobius details transmembrane" amino acids 16 to 33 (18 residues), see Phobius details TIGR02281: clan AA aspartic protease, TIGR02281 family" amino acids 52 to 165 (114 residues), 98 bits, see alignment E=2.1e-32 PF13975: gag-asp_proteas" amino acids 65 to 152 (88 residues), 91.1 bits, see alignment E=5.5e-30 PF13650: Asp_protease_2" amino acids 65 to 149 (85 residues), 80.2 bits, see alignment E=1.6e-26

Best Hits

KEGG orthology group: K06985, aspartyl protease family protein (inferred from 63% identity to meh:M301_1073)

Predicted SEED Role

"peptidase A2A, retrovirus, catalytic"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (168 amino acids)

>GFF68 hypothetical protein (Methylophilus sp. DMC18)
MSMRHATQKNHLRGRSLLYTLLWLGLAALIWFLVDRVQHPNTLEQLGQQKVVTLKRGTDG
HYSAEALINGERVRVLVDTGATGVAISQNVADRLGLVSHDAISTHTANGTAVAYLVRLKT
VQLGGVVAHDVAATISPGLEGDALLGMSFLGRMDVRLYQGTMTIQNAE