Protein Info for GFF6794 in Variovorax sp. SCN45

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 513 transmembrane" amino acids 36 to 56 (21 residues), see Phobius details amino acids 96 to 117 (22 residues), see Phobius details amino acids 124 to 143 (20 residues), see Phobius details amino acids 149 to 170 (22 residues), see Phobius details amino acids 178 to 208 (31 residues), see Phobius details amino acids 220 to 240 (21 residues), see Phobius details amino acids 318 to 338 (21 residues), see Phobius details amino acids 344 to 363 (20 residues), see Phobius details amino acids 374 to 393 (20 residues), see Phobius details PF13231: PMT_2" amino acids 78 to 238 (161 residues), 85 bits, see alignment E=3.4e-28

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (513 amino acids)

>GFF6794 hypothetical protein (Variovorax sp. SCN45)
MLLQSDSRASVPGRPALDLGALLPSSRFPAARTSEVALWMAVWAIAWITLLSALTWSPPT
DSVEQLTWVRSVEWGYYKHPPLPTILIWPLVRVFGIHEWVVGAAGALVISAALLISWRLV
RELAGRHFAALALLGSLCITYYSTRTNFYNHNTVLLPFVAAAAWFCWRAFADRSQGAWLA
LGLMLGLGALAKYQVALAGVSVIAFWLVKRGWRDMLHVRGLLSAGFVAALVFAPHLWWLV
AHDFLPFQYASRTSLGAALPCVQRAAHALHWLADQCNRASPALLLAAGLLWKTRRAAVVP
PGVLSAREVPAVHPDARLFLFAWGLLPLLTIVLIGLATGADLQFQWGTAFMSFTCAALML
FVPAERWQRIAWRHALAGFVVVQLLLVAMAWATSPVSGLGLSKSRSADFRSANLAARIGP
QARIALDGPIRVITGPARIASALSLRLSERPLVLLEGDLVASPWVSPAQIERYGVLWVGD
DHLAPPPGLNVHWETEQLWWAVQQPAEGRVDAY