Protein Info for PS417_03450 in Pseudomonas simiae WCS417

Annotation: RNA polymerase sigma factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 183 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 25 to 176 (152 residues), 67.9 bits, see alignment E=4e-23 PF04542: Sigma70_r2" amino acids 27 to 86 (60 residues), 47.9 bits, see alignment E=1.9e-16 PF08281: Sigma70_r4_2" amino acids 122 to 173 (52 residues), 39.2 bits, see alignment E=9e-14 PF04545: Sigma70_r4" amino acids 126 to 174 (49 residues), 32.8 bits, see alignment E=7.9e-12 PF13556: HTH_30" amino acids 135 to 180 (46 residues), 31.9 bits, see alignment E=1.9e-11

Best Hits

Swiss-Prot: 48% identical to HRPL_PSESY: RNA polymerase sigma factor HrpL (hrpL) from Pseudomonas syringae pv. syringae

KEGG orthology group: None (inferred from 96% identity to pfs:PFLU0709)

Predicted SEED Role

"RNA polymerase sigma-54 factor RpoN" in subsystem Flagellar motility or Flagellum or Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U4D1 at UniProt or InterPro

Protein Sequence (183 amino acids)

>PS417_03450 RNA polymerase sigma factor (Pseudomonas simiae WCS417)
MNIPIEALAHLVGSSPQFMLHLTDEQQKKLRRFIHKRVLNPEDADDLLQLTYLEAWRNRE
RFSGNATLSTWMCGIAQNLIRNHFRRMYAKPVHCEFDESLWHGQEDNRNLDWEFEVNRRL
EKTLSAIDHLPVEMRKTLYASLETDGSYQDTADALDIPIGTVRSRLSRAREQLKRATHNP
KHP