Protein Info for GFF6777 in Variovorax sp. SCN45

Annotation: ABC transporter, ATP-binding protein (cluster 1, maltose/g3p/polyamine/iron); ABC transporter, ATP-binding protein (cluster 10, nitrate/sulfonate/bicarbonate)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 PF00005: ABC_tran" amino acids 20 to 161 (142 residues), 116.6 bits, see alignment E=2.7e-37 PF17912: OB_MalK" amino acids 235 to 285 (51 residues), 39.8 bits, see alignment 1.3e-13 PF08402: TOBE_2" amino acids 279 to 347 (69 residues), 24.4 bits, see alignment E=5.1e-09

Best Hits

Swiss-Prot: 61% identical to Y4OS_SINFN: Uncharacterized ABC transporter ATP-binding protein y4oS (NGR_a02170) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K02023, multiple sugar transport system ATP-binding protein (inferred from 92% identity to vpe:Varpa_4258)

Predicted SEED Role

"Maltose/maltodextrin transport ATP-binding protein MalK (EC 3.6.3.19)" in subsystem Maltose and Maltodextrin Utilization (EC 3.6.3.19)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (356 amino acids)

>GFF6777 ABC transporter, ATP-binding protein (cluster 1, maltose/g3p/polyamine/iron); ABC transporter, ATP-binding protein (cluster 10, nitrate/sulfonate/bicarbonate) (Variovorax sp. SCN45)
MASVSFRNIQKSFGKVQIIKGLGFDITDGEFVVLVGPSGCGKSTLLRMLAGLEDISGGEI
MIDGRVVNDLESKDRDIAMVFQSYALYPHMTVGENMGFSLRLRSAEKSVTDERVARAAKI
LNLDSLLGRYPRELSGGQRQRVAMGRAIVRDPKVFLFDEPLSNLDAKLRVAMRAEIKALH
QRLKTTTVYVTHDQIEAMTMADRIVVMHDGIVEQIGTPLDLYDRPDNLFVAQFIGSPSMN
VIEGTVRRAGGDCWVEAQGARWPVPAATSAPDGQPVHYGVRPGDITLGGAAQSVAAKVIV
VEPTGAETELLVQVGEARLVLAVHGRVDARPDEIVNLAIDTPRVHLFDRQTGRRMG