Protein Info for GFF6761 in Variovorax sp. SCN45

Annotation: Ferric iron ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 558 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 60 to 84 (25 residues), see Phobius details amino acids 95 to 115 (21 residues), see Phobius details amino acids 150 to 171 (22 residues), see Phobius details amino acids 192 to 214 (23 residues), see Phobius details amino acids 245 to 265 (21 residues), see Phobius details amino acids 292 to 318 (27 residues), see Phobius details amino acids 340 to 363 (24 residues), see Phobius details amino acids 382 to 402 (21 residues), see Phobius details amino acids 414 to 434 (21 residues), see Phobius details amino acids 473 to 490 (18 residues), see Phobius details amino acids 524 to 542 (19 residues), see Phobius details PF00528: BPD_transp_1" amino acids 76 to 265 (190 residues), 52.3 bits, see alignment E=3e-18 amino acids 374 to 541 (168 residues), 26.7 bits, see alignment E=2.1e-10

Best Hits

KEGG orthology group: K02011, iron(III) transport system permease protein (inferred from 93% identity to vpe:Varpa_4276)

Predicted SEED Role

"Ferric iron ABC transporter, permease protein" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (558 amino acids)

>GFF6761 Ferric iron ABC transporter, permease protein (Variovorax sp. SCN45)
MNIGGRYGGLQAAGPAWRCASFLIALGVLAPVLTLAWLAFGSGVGHWGPLFAHVLPQAAL
NTALLLAGVGTLVLLIGTGCAWLVTAHDFPGRGVLHWALLLPLAMPTYIVAFAYLDLLHP
IGPVQGAIRWMLGFDSPRQFRLPDLRSMPGAIFVLGFVLYPYVYMTARAMFMTQPAHLME
AARMLGESRRGAFFRVALPLARPALAVGLSLALLETLNDIGASEFLGVNTLTVAVYTTWI
TRSDLAGAAQIACAMLFMVVALVWLERSGRRHQRFGSAQRMRAVQPRRLRGGAAWAATAA
AALPVLIGFVAPALYLVWESAKRLRQGGGISQGLLASLGNTLALAAGVTVAAVAAGLVVA
WAARTQGSGINRARWQARVATLGYAVPGTVLAIGLLTPALAFDAALATAFGWQGLPLMAA
GVVLVVACTIRFLAMPVGGIEAGLSRIPPAIEQASRLLGETTGGTLRRVHLPLLRPALAA
GALLVFVDAMKELPATLLLRPANFDTLATWLYAEAARGTYEEGAIAALAIVLAGLLPVVL
LARNQLGTPAATFSPDTP